| Primary information |
|---|
| ID | 12947 |
| Uniprot ID | P16860 |
| Description | Natriuretic peptides B (Brain natriuretic factor prohormone) (preproBNP) (proBNP) (Gamma-brain natriuretic peptide) (Iso-ANP) [Cleaved into- NT-proBNP (NT-pro-BNP) (NT-proBNP(1-76)); proBNP(3-108); Brain natriuretic peptide 32 (BNP(1-32)) (BNP-32) (Brain natriuretic peptide) (BNP); BNP(1-30); BNP(1- |
| Organism | Homo sapiens |
| Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Euarchontoglires; Primates; Haplorrhini; Simiiformes; Catarrhini; Hominoidea (apes); Hominidae (great apes); Homininae; Homo; Homo sapiens (Human) |
| Subcellular Location | [NT-proBNP]- Secreted |
| Developmental Stage | NA |
| Similarity | Belongs to the natriuretic peptide family. |
| Tissue Specificity | [Brain natriuretic peptide 32]- Detected in the cardiac atria (at protein level) (PubMed-2138890; PubMed-2136732). Detected in the kidney distal tubular cells (at protein level) (PubMed-9794555). |
| Post Translational Modification | The precursor molecule is proteolytically cleaved by the endoproteases FURIN or CORIN at Arg-102 to produce brain natriuretic peptide 32 and NT-proBNP (PubMed-21314817; PubMed-10880574; PubMed-2176327 |
| Function | [Brain natriuretic peptide 32]- Cardiac hormone that plays a key role in mediating cardio-renal homeostasis |
| Length | 134 |
| Molecular Weight | 14 |
| Name | Natriuretic peptides B |
| Sequence | SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH |
| Sequence map | 768 |
| PDB ID | 2597152; 2522777; 16710414; 15489334; 2138890; 2136732; 1914098; 1672777; 9458824; 9794555; |
| Drugpedia | 1YK1;3N56; |
| Receptor | P16066 |
| Domain | NA |
| Pharmaceutical Use | Available under the name Nesiritide (Scios). Used for the treatment of heart failure.
|