Primary information |
---|
ID | 12931 |
Uniprot ID | Q9TUI9 |
Description | Apelin (APJ endogenous ligand) [Cleaved into- Apelin-36; Apelin-31; Apelin-28; Apelin-13] |
Organism | Bos taurus |
Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Laurasiatheria; Artiodactyla; Ruminantia; Pecora; Bovidae; Bovinae; Bos (oxen; cattle); Bos taurus (Bovine) |
Subcellular Location | Secreted |
Developmental Stage | NA |
Similarity | Belongs to the apelin family. |
Tissue Specificity | NA |
Post Translational Modification | At least 5 active peptides may be produced by proteolytic processing of the peptide precursor (PubMed-9792798). |
Function | Endogenous ligand for the apelin receptor (APLNR) |
Length | 77 |
Molecular Weight | 8 |
Name | Apelin |
Sequence | LVQPRGPRSGPGPWQGGRRKFRRQRPRLSHKGPMPF |
Sequence map | 864 |
PDB ID | 9792798; 10525157 |
Drugpedia | NA |
Receptor | NA |
Domain | NA |
Pharmaceutical Use | NA
|