| Primary information |
|---|
| ID | 12930 |
| Uniprot ID | Q9TUI9 |
| Description | Apelin (APJ endogenous ligand) [Cleaved into- Apelin-36; Apelin-31; Apelin-28; Apelin-13] |
| Organism | Bos taurus |
| Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Laurasiatheria; Artiodactyla; Ruminantia; Pecora; Bovidae; Bovinae; Bos (oxen; cattle); Bos taurus (Bovine) |
| Subcellular Location | Secreted |
| Developmental Stage | NA |
| Similarity | Belongs to the apelin family. |
| Tissue Specificity | NA |
| Post Translational Modification | At least 5 active peptides may be produced by proteolytic processing of the peptide precursor (PubMed-9792798). |
| Function | Endogenous ligand for the apelin receptor (APLNR) |
| Length | 77 |
| Molecular Weight | 8 |
| Name | Apelin |
| Sequence | GPRSGPGPWQGGRRKFRRQRPRLSHKGPMPF |
| Sequence map | 744 |
| PDB ID | 9792798; 10525157 |
| Drugpedia | NA |
| Receptor | NA |
| Domain | NA |
| Pharmaceutical Use | NA
|