| Primary information |
|---|
| ID | 12927 |
| Uniprot ID | P43145 |
| Description | Pro-adrenomedullin [Cleaved into- Adrenomedullin (AM); Proadrenomedullin N-20 terminal peptide (ProAM N-terminal 20 peptide) (PAMP) (ProAM-N20)] |
| Organism | Rattus norvegicus |
| Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Euarchontoglires; Glires (Rodents and rabbits); Rodentia; Myomorpha (mice and others); Muroidea; Muridae; Murinae; Rattus; Rattus norvegicus (Rat) |
| Subcellular Location | Secreted |
| Developmental Stage | NA |
| Similarity | Belongs to the adrenomedullin family. |
| Tissue Specificity | Expressed in adrenal glands; lung; kidney; heart; spleen; duodenum and submandibular glands. |
| Post Translational Modification | NA |
| Function | AM and PAMP are potent hypotensive and vasodilatator agents. |
| Length | 185 |
| Molecular Weight | 20 |
| Name | Pro-adrenomedullin |
| Sequence | YRQSMNQGSRSTGCRFGTCTMQKLAHQIYQFTDKDKDGMAPRNKISPQGY |
| Sequence map | 1200 |
| PDB ID | 7690563; 8524787; 15489334; 26479776 |
| Drugpedia | NA |
| Receptor | NA |
| Domain | NA |
| Pharmaceutical Use | NA
|