| Primary information |
|---|
| ID | 12925 |
| Uniprot ID | Q7TNK8 |
| Description | Protein ADM2 (Intermedin) [Cleaved into- Adrenomedullin-2 (AM2) (Intermedin-long) (IMDL); Intermedin-short (IMDS)] |
| Organism | Mus musculus |
| Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Euarchontoglires; Glires (Rodents and rabbits); Rodentia; Myomorpha (mice and others); Muroidea; Muridae; Murinae; Mus; Mus; Mus musculus (Mouse) |
| Subcellular Location | Secreted |
| Developmental Stage | NA |
| Similarity | Belongs to the adrenomedullin family. |
| Tissue Specificity | High expression detected in the submaxillary gland; kidney; stomach; and mesentery; followed by the pituitary; lung; pancreas; intestines; spleen; thymus and ovary. Expressed mainly in the intermediat |
| Post Translational Modification | NA |
| Function | [Adrenomedullin-2]- May play a role as physiological regulators of gastrointestinal; cardiovascular bioactivities mediated by the CALCRL/RAMPs receptor complexes. Activates the cAMP-dependent pathway. |
| Length | 150 |
| Molecular Weight | 16 |
| Name | Protein ADM2 |
| Sequence | PHAQLLRVGCVLGTCQVQNLSHRLWQLVRPAGRRDSAPVDPSSPHSY |
| Sequence map | 1128 |
| PDB ID | 14615490; 14706825; 15489334 |
| Drugpedia | NA |
| Receptor | NA |
| Domain | NA |
| Pharmaceutical Use | NA
|