| Primary information |
|---|
| ID | 12918 |
| Uniprot ID | Q8CE23 |
| Description | Orexigenic neuropeptide QRFP (P518) [Cleaved into- QRF-amide (Neuropeptide RF-amide) (Pyroglutamylated arginine-phenylalanine-amide peptide)] |
| Organism | Mus musculus |
| Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Euarchontoglires; Glires (Rodents and rabbits); Rodentia; Myomorpha (mice and others); Muroidea; Muridae; Murinae; Mus; Mus; Mus musculus (Mouse) |
| Subcellular Location | Secreted |
| Developmental Stage | NA |
| Similarity | Belongs to the RFamide neuropeptide family. |
| Tissue Specificity | Expressed in the brain with highest levels in the periventricular hypothalamic nucleus and lateral hypothalamic areas. Expressed at moderate levels in the adrenal gland; eye; heart; intestine; liver; |
| Post Translational Modification | NA |
| Function | Stimulates feeding and grooming behavior; metabolic rate and locomotor activity and increases blood pressure. May have orexigenic activity. May promote aldosterone secretion by the adrenal gland. |
| Length | 124 |
| Molecular Weight | 13 |
| Name | Orexigenic neuropeptide QRFP |
| Sequence | QDGSSEAAGFLPADSEKASGPLGTLAEELSSYSRRKGGFSFRF |
| Sequence map | 1032 |
| PDB ID | 12714592; 12960173; 16141072; 19468303; 16648250 |
| Drugpedia | NA |
| Receptor | NA |
| Domain | NA |
| Pharmaceutical Use | NA
|