Primary information |
---|
ID | 12918 |
Uniprot ID | Q8CE23 |
Description | Orexigenic neuropeptide QRFP (P518) [Cleaved into- QRF-amide (Neuropeptide RF-amide) (Pyroglutamylated arginine-phenylalanine-amide peptide)] |
Organism | Mus musculus |
Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Euarchontoglires; Glires (Rodents and rabbits); Rodentia; Myomorpha (mice and others); Muroidea; Muridae; Murinae; Mus; Mus; Mus musculus (Mouse) |
Subcellular Location | Secreted |
Developmental Stage | NA |
Similarity | Belongs to the RFamide neuropeptide family. |
Tissue Specificity | Expressed in the brain with highest levels in the periventricular hypothalamic nucleus and lateral hypothalamic areas. Expressed at moderate levels in the adrenal gland; eye; heart; intestine; liver; |
Post Translational Modification | NA |
Function | Stimulates feeding and grooming behavior; metabolic rate and locomotor activity and increases blood pressure. May have orexigenic activity. May promote aldosterone secretion by the adrenal gland. |
Length | 124 |
Molecular Weight | 13 |
Name | Orexigenic neuropeptide QRFP |
Sequence | QDGSSEAAGFLPADSEKASGPLGTLAEELSSYSRRKGGFSFRF |
Sequence map | 1032 |
PDB ID | 12714592; 12960173; 16141072; 19468303; 16648250 |
Drugpedia | NA |
Receptor | NA |
Domain | NA |
Pharmaceutical Use | NA
|