| Primary information |
|---|
| ID | 12917 |
| Uniprot ID | P83859 |
| Description | Orexigenic neuropeptide QRFP (P518) [Cleaved into- QRF-amide (Neuropeptide RF-amide) (Pyroglutamylated arginine-phenylalanine-amide peptide)] |
| Organism | Homo sapiens |
| Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Euarchontoglires; Primates; Haplorrhini; Simiiformes; Catarrhini; Hominoidea (apes); Hominidae (great apes); Homininae; Homo; Homo sapiens (Human) |
| Subcellular Location | Secreted |
| Developmental Stage | NA |
| Similarity | Belongs to the RFamide neuropeptide family. |
| Tissue Specificity | Expressed widely in the brain with highest expression levels in the cerebellum; medulla; pituitary; retina; vestibular nucleus; and white matter. Also expressed in the bladder; colon; coronary artery; |
| Post Translational Modification | NA |
| Function | Stimulates feeding behavior; metabolic rate and locomotor activity and increases blood pressure. May have orexigenic activity. May promote aldosterone secretion by the adrenal gland. |
| Length | 136 |
| Molecular Weight | 14 |
| Name | Orexigenic neuropeptide QRFP |
| Sequence | QDEGSEATGFLPAAGEKTSGPLGNLAEELNGYSRKKGGFSFRF |
| Sequence map | 1032 |
| PDB ID | 12714592; 12960173; 14657341; 14574404; 15489334 |
| Drugpedia | NA |
| Receptor | Q96P65 |
| Domain | NA |
| Pharmaceutical Use | NA
|