| Primary information |
|---|
| ID | 12915 |
| Uniprot ID | P83860 |
| Description | Orexigenic neuropeptide QRFP (P518) [Cleaved into- QRF-amide (Neuropeptide RF-amide) (Pyroglutamylated arginine-phenylalanine-amide peptide)] |
| Organism | Rattus norvegicus |
| Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Euarchontoglires; Glires (Rodents and rabbits); Rodentia; Myomorpha (mice and others); Muroidea; Muridae; Murinae; Rattus; Rattus norvegicus (Rat) |
| Subcellular Location | Secreted |
| Developmental Stage | NA |
| Similarity | Belongs to the RFamide neuropeptide family. |
| Tissue Specificity | Expressed in the brain with highest expression levels in the hypothalamus and optic nerve. Also expressed in the trachea and mammary gland. |
| Post Translational Modification | NA |
| Function | Stimulates feeding and grooming behavior; metabolic rate and locomotor activity and increases blood pressure. May have orexigenic activity. May promote aldosterone secretion by the adrenal gland. |
| Length | 124 |
| Molecular Weight | 13 |
| Name | Orexigenic neuropeptide QRFP |
| Sequence | QDSGSEATGFLPTDSEKASGPLGTLAEELSSYSRRKGGFSFRF |
| Sequence map | 1032 |
| PDB ID | 12960173; 14657341; 16648250 |
| Drugpedia | NA |
| Receptor | NA |
| Domain | NA |
| Pharmaceutical Use | NA
|