| Primary information |
|---|
| ID | 12908 |
| Uniprot ID | C0HJT9 |
| Description | Insulin [Cleaved into- Insulin B chain; Insulin A chain] |
| Organism | Seriola quinqueradiata |
| Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Actinopterygii; Actinopteri; Neopterygii; Teleostei; Osteoglossocephalai; Clupeocephala; Euteleosteomorpha; Neoteleostei; Eurypterygia; Ctenosquamata; Acanthomorphata; Euacanthomorphacea; Percomorphaceae; Carangaria; Carangiformes (jacks and others); Carangidae (jacks); Seriola; Seriola quinqueradiata (Five-ray yellowtail) |
| Subcellular Location | Secreted |
| Developmental Stage | NA |
| Similarity | Belongs to the insulin family. |
| Tissue Specificity | NA |
| Post Translational Modification | NA |
| Function | Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides; amino acids and fatty acids. It accelerates glycolysis; the pentose phosphate cycle; and glycogen synthesis in liver. |
| Length | 51 |
| Molecular Weight | 5 |
| Name | Insulin |
| Sequence | VAPPQHLCGSHLVDALYLVCGDRGFFYNPK |
| Sequence map | 720 |
| PDB ID | 26743346 |
| Drugpedia | NA |
| Receptor | NA |
| Domain | NA |
| Pharmaceutical Use | NA
|