| Primary information |
|---|
| ID | 12889 |
| Uniprot ID | P18104 |
| Description | C-type natriuretic peptide [Cleaved into- CNP-22; CNP-29; CNP-53] |
| Organism | Sus scrofa |
| Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Laurasiatheria; Artiodactyla; Suina; Suidae (pigs); Sus; Sus scrofa (Pig) |
| Subcellular Location | Secreted |
| Developmental Stage | NA |
| Similarity | Belongs to the natriuretic peptide family. |
| Tissue Specificity | NA |
| Post Translational Modification | [CNP-22]- Degraded by IDE (in vitro). |
| Function | [CNP-22]- Hormone which plays a role in endochondral ossification through regulation of cartilaginous growth plate chondrocytes proliferation and differentiation. May also be vasoactive and natriuretic. Acts by specifically binding and stimulating NPR2 to produce cGMP. Binds the clearance receptor NPR3. |
| Length | 126 |
| Molecular Weight | 13 |
| Name | C-type natriuretic peptide |
| Sequence | DLRVDTKSRAAWARLLHEHPNARKYKGGNKKGLSKGCFGLKLDRIGSMSGLGC |
| Sequence map | 1272 |
| PDB ID | 2146957; 2383278; 2139780 |
| Drugpedia | NA |
| Receptor | NA |
| Domain | NA |
| Pharmaceutical Use | NA
|