Primary information |
---|
ID | 12877 |
Uniprot ID | P20156 |
Description | Neurosecretory protein VGF (VGF8a protein) [Cleaved into- VGF(24-63); VGF(180-194); VGF(375-407); Neuroendocrine regulatory peptide-1 (NERP-1); Neuroendocrine regulatory peptide-2 (NERP-2); VGF-derived peptide TLQP-11; VGF-derived peptide TLQP-21; VGF-derived peptide TLQP-30; VGF-derived peptide TLQ |
Organism | Rattus norvegicus |
Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Euarchontoglires; Glires (Rodents and rabbits); Rodentia; Myomorpha (mice and others); Muroidea; Muridae; Murinae; Rattus; Rattus norvegicus (Rat) |
Subcellular Location | [Neurosecretory protein VGF]- Secreted |
Developmental Stage | NA |
Similarity | NA |
Tissue Specificity | Central and peripheral nervous systems; synthesized exclusively in neuronal and neuroendocrine cells. VGF and several of the derived peptides are present in the brain. |
Post Translational Modification | Multiple peptides are derived from VGF; with activities in synaptic plasticity; antidepression; penile erection; autonomic activation; and increases in energy expenditure. |
Function | [Neurosecretory protein VGF]- Secreted polyprotein that is packaged and proteolytically processed by prohormone convertases PCSK1 and PCSK2 in a cell-type-specific manner |
Length | 617 |
Molecular Weight | 68 |
Name | Neurosecretory protein VGF |
Sequence | TLQPPASSRRRHFHHALPPARHHPDLEAQARRAQEEADAEERRLQEQEELENYIEHVLLHRP |
Sequence map | 1488 |
PDB ID | 2676516; 2017159; 1377233; 7595538; 12065665; 16983076; 19164277; 19466987; 19194657; 20551 |
Drugpedia | NA |
Receptor | NA |
Domain | NA |
Pharmaceutical Use | NA
|