Primary information |
---|
ID | 12868 |
Uniprot ID | P09475 |
Description | Pancreatic propolypeptide YG (APY) [Cleaved into- Pancreatic polypeptide YG; Carboxy-terminal peptide] (Fragment) |
Organism | Lophius americanus |
Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Actinopterygii; Actinopteri; Neopterygii; Teleostei; Osteoglossocephalai; Clupeocephala; Euteleosteomorpha; Neoteleostei; Eurypterygia; Ctenosquamata; Acanthomorphata; Euacanthomorphacea; Percomorphaceae; Eupercaria; Lophiiformes (anglerfishes); Lophioidei; Lophiidae (goosefishes); Lophius; Lophius americanus (American angler) (Angler |
Subcellular Location | Secreted |
Developmental Stage | NA |
Similarity | Belongs to the NPY family. |
Tissue Specificity | NA |
Post Translational Modification | NA |
Function | NA |
Length | 69 |
Molecular Weight | 7 |
Name | Pancreatic propolypeptide YG |
Sequence | YPPKPETPGSNASPEDWASYQAAVRHYVNLITRQRYG |
Sequence map | 888 |
PDB ID | 3838934; 3520508; 3522578 |
Drugpedia | NA |
Receptor | NA |
Domain | NA |
Pharmaceutical Use | NA
|