Primary information |
---|
ID | 12847 |
Uniprot ID | P06767 |
Description | Protachykinin-1 (PPT) [Cleaved into- Substance P; Neurokinin A (NKA) (Neuromedin L) (Substance K); Neuropeptide K (NPK); Neuropeptide gamma; C-terminal-flanking peptide] |
Organism | Rattus norvegicus |
Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Euarchontoglires; Glires (Rodents and rabbits); Rodentia; Myomorpha (mice and others); Muroidea; Muridae; Murinae; Rattus; Rattus norvegicus (Rat) |
Subcellular Location | Secreted |
Developmental Stage | NA |
Similarity | Belongs to the tachykinin family. |
Tissue Specificity | NA |
Post Translational Modification | The substance P form is cleaved at Pro-59 by the prolyl endopeptidase FAP (seprase) activity (in vitro). |
Function | Tachykinins are active peptides which excite neurons; evoke behavioral responses; are potent vasodilators and secretagogues; and contract (directly or indirectly) many smooth muscles. |
Length | 130 |
Molecular Weight | 15 |
Name | Protachykinin-1 |
Sequence | DADSSIEKQVALLKALYGHGQISHKRHKTDSFVGLM |
Sequence map | 864 |
PDB ID | 1695945; 2433692; 2429656; 1702066; 8448217; 7519424; 2809597 |
Drugpedia | NA |
Receptor | NA |
Domain | NA |
Pharmaceutical Use | NA
|