| Primary information |
|---|
| ID | 12834 |
| Uniprot ID | P41539 |
| Description | Protachykinin-1 (PPT) [Cleaved into- Substance P; Neurokinin A (NKA) (Neuromedin L) (Substance K); Neuropeptide K (NPK); Neuropeptide gamma; C-terminal-flanking peptide] |
| Organism | Mus musculus |
| Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Euarchontoglires; Glires (Rodents and rabbits); Rodentia; Myomorpha (mice and others); Muroidea; Muridae; Murinae; Mus; Mus; Mus musculus (Mouse) |
| Subcellular Location | Secreted |
| Developmental Stage | NA |
| Similarity | Belongs to the tachykinin family. |
| Tissue Specificity | NA |
| Post Translational Modification | The substance P form is cleaved at Pro-59 by the prolyl endopeptidase FAP (seprase) activity (in vitro). |
| Function | Tachykinins are active peptides which excite neurons; evoke behavioral responses; are potent vasodilators and secretagogues; and contract (directly or indirectly) many smooth muscles. |
| Length | 130 |
| Molecular Weight | 15 |
| Name | Protachykinin-1 |
| Sequence | DADSSVEKQVALLKALYGHGQISHKRHKTDSFVGLM |
| Sequence map | 864 |
| PDB ID | 1708336 |
| Drugpedia | NA |
| Receptor | NA |
| Domain | NA |
| Pharmaceutical Use | NA
|