| Primary information |
|---|
| ID | 12812 |
| Uniprot ID | Q9XSW6 |
| Description | Pro-neuropeptide Y [Cleaved into- Neuropeptide Y (Neuropeptide tyrosine) (NPY); C-flanking peptide of NPY (CPON)] |
| Organism | Macaca mulatta |
| Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Euarchontoglires; Primates; Haplorrhini; Simiiformes; Catarrhini; Cercopithecoidea; Cercopithecidae (Old World monkeys); Cercopithecinae; Macaca (macaques); Macaca mulatta (Rhesus macaque) |
| Subcellular Location | Secreted Cytoplasmic vesicle; secretory vesicle; neuronal dense core vesicle |
| Developmental Stage | NA |
| Similarity | Belongs to the NPY family. |
| Tissue Specificity | NA |
| Post Translational Modification | The neuropeptide Y form is cleaved at Pro-30 by the prolyl endopeptidase FAP (seprase) activity (in vitro). |
| Function | NPY is implicated in the control of feeding and in secretion of gonadotrophin-release hormone. |
| Length | 97 |
| Molecular Weight | 10 |
| Name | Pro-neuropeptide Y |
| Sequence | YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY |
| Sequence map | 864 |
| PDB ID | 14718659 |
| Drugpedia | 1R9N; |
| Receptor | NA |
| Domain | NA |
| Pharmaceutical Use | NA
|