| Primary information |
|---|
| ID | 12807 |
| Uniprot ID | P05060 |
| Description | Secretogranin-1 (Chromogranin-B) (CgB) (Secretogranin I) (SgI) [Cleaved into- PE-11; GAWK peptide; CCB peptide] |
| Organism | Homo sapiens |
| Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Euarchontoglires; Primates; Haplorrhini; Simiiformes; Catarrhini; Hominoidea (apes); Hominidae (great apes); Homininae; Homo; Homo sapiens (Human) |
| Subcellular Location | Secreted Note=Neuroendocrine and endocrine secretory granules. |
| Developmental Stage | NA |
| Similarity | Belongs to the chromogranin/secretogranin protein family. |
| Tissue Specificity | Expressed in the adrenal medulla; and in pheochromocytoma. Not expressed in liver. |
| Post Translational Modification | Extensively processed by limited proteolysis at conserved basic residues. Alternative processing are seen in different tissues. |
| Function | Secretogranin-1 is a neuroendocrine secretory granule protein; which may be the precursor for other biologically active peptides. |
| Length | 677 |
| Molecular Weight | 78 |
| Name | Secretogranin-1 |
| Sequence | FLGEGHHRVQENQMDKARRHPQGAWKELDRNYLNYGEEGAPGKWQQQGDLQDTKENREEARFQDKQYSSHHTAE |
| Sequence map | 1776 |
| PDB ID | 3608978; 14702039; 11780052; 15489334; 1882087; 7784254; 3970711; 3678488; 14997482; 168076 |
| Drugpedia | NA |
| Receptor | NA |
| Domain | NA |
| Pharmaceutical Use | NA
|