| Primary information |
|---|
| ID | 12796 |
| Uniprot ID | P85826 |
| Description | Diuretic hormone class 2 (DH(31)) (Diuretic peptide) (DP) (Rhopr-DH31) [Cleaved into- Diuretic hormone class 2(1-16) (Rhopr-DH31(1-16))] |
| Organism | Rhodnius prolixus |
| Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Protostomia; Ecdysozoa; Panarthropoda; Arthropoda; Mandibulata; Pancrustacea; Hexapoda; Insecta; Dicondylia; Pterygota (winged insects); Neoptera; Paraneoptera; Hemiptera; Prosorrhyncha (bugs); Heteroptera (true bugs); Euheteroptera; Neoheteroptera; Panheteroptera; Cimicomorpha; Reduvioidea; Reduviidae (assassin bugs); Triatominae (kissing bugs); Rhodnius; Rhodnius prolixus (Triatomid bug) |
| Subcellular Location | Perikaryon |
| Developmental Stage | NA |
| Similarity | Belongs to the diuretic hormone class 2 family. |
| Tissue Specificity | Detected throughout the central nervous system in fifth instar larvae; particularly in the medial and lateral neurosecretory cells and the dorsal unpaired median neurons of the mesothoracic ganglionic |
| Post Translational Modification | NA |
| Function | Regulation of fluid secretion. Stimulates primary urine secretion by the Malpighian tubules. Increases the frequency of contraction in the heart and hindgut. Causes a dose-dependent stimulation of cAMP levels in the dorsal vessel and hindgut; but not in Malpighian tubules. Has synergistic effects on urine secretion by Malpighian tubules with serotonin. |
| Length | 31 |
| Molecular Weight | 2 |
| Name | Diuretic hormone class 2 |
| Sequence | GLDLGLSRGFSGSQAAKHLMGLAAANYAGGP |
| Sequence map | 744 |
| PDB ID | 18203994; 19137558; 15626502 |
| Drugpedia | NA |
| Receptor | NA |
| Domain | NA |
| Pharmaceutical Use | NA
|