| Primary information |
|---|
| ID | 12784 |
| Uniprot ID | Q566B3 |
| Description | Partner of bursicon (Bursicon subunit beta) |
| Organism | Anopheles gambiae |
| Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Protostomia; Ecdysozoa; Panarthropoda; Arthropoda; Mandibulata; Pancrustacea; Hexapoda; Insecta; Dicondylia; Pterygota (winged insects); Neoptera; Endopterygota; Diptera; Nematocera; Culicomorpha; Culicoidea; Culicidae (mosquitos); Anophelinae; Anopheles; Cellia; Pyretophorus; gambiae species complex; Anopheles gambiae (African malaria mosquito) |
| Subcellular Location | Secreted |
| Developmental Stage | NA |
| Similarity | NA |
| Tissue Specificity | NA |
| Post Translational Modification | NA |
| Function | Final heterodimeric neurohormone released at the end of the molting cycle; involved in the sclerotization (tanning) of the insect cuticle; melanization and wing spreading. |
| Length | 153 |
| Molecular Weight | 17 |
| Name | Partner of bursicon |
| Sequence | HNQADETCETLPSEIHLIKEEYDELGRLYRTCNGDVTVNKCEGKCNSQVQPSVITATGFLKECYCCRESFLRERQLQLTHCYDPDGVRMTDHESATMEIRLKEPVDCKCFKCGEMVR |
| Sequence map | 38-33 |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | NA |
| Domain | NA |
| Pharmaceutical Use | NA
|