| Primary information |
|---|
| ID | 12772 |
| Uniprot ID | Q9VBV3 |
| Description | Protein takeout |
| Organism | Drosophila melanogaster |
| Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Protostomia; Ecdysozoa; Panarthropoda; Arthropoda; Mandibulata; Pancrustacea; Hexapoda; Insecta; Dicondylia; Pterygota (winged insects); Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Eremoneura; Cyclorrhapha; Schizophora; Acalyptratae; Ephydroidea; Drosophilidae (pomace flies); Drosophilinae; Drosophilini; Drosophila (fruit flies); Sophophora; melanogaster group; melanogaster subgroup; Drosophila melanogaster (Fruit fly) |
| Subcellular Location | Secreted |
| Developmental Stage | NA |
| Similarity | Belongs to the TO family. |
| Tissue Specificity | Expression is largely restricted to head; with limited expression detectable in cardia and crop. In entrained individuals; expression is observed in the brain cortex (region between optic lobe and cen |
| Post Translational Modification | NA |
| Function | Participates in a novel circadian output pathway that conveys temporal and food status information to feeding-relevant metabolisms and activities. Involved in male courtship behavior. In the brain-associated fat body; transcription is enhanced by the dsx and fru male-specific isoforms and repressed by the dsx female-specific isoform. |
| Length | 249 |
| Molecular Weight | 27 |
| Name | Protein takeout |
| Sequence | FPEDPKPCKYGDGECIMKLCNTLFSENSAEGDPGLNLMQLDPLKVDRMVISQGESSSPVGITLTFTDNLLYGIKDQRIVKVKGFGRDLTAKHEVKIVTKTFSLVGPYNIQGKVLILPISGTGQSNMTMVNVRAIVSFSGKPLVKNGETYLDVTDLKITMKPESSHYHFSNLFNGDKALGDNMNVFLNENSEAIYKETAKAIDRSFGKLYLGVVKGVFSKLPYAKFFADES |
| Sequence map | 23-09 |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | NA |
| Domain | NA |
| Pharmaceutical Use | NA
|