Primary information |
---|
ID | 12772 |
Uniprot ID | Q9VBV3 |
Description | Protein takeout |
Organism | Drosophila melanogaster |
Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Protostomia; Ecdysozoa; Panarthropoda; Arthropoda; Mandibulata; Pancrustacea; Hexapoda; Insecta; Dicondylia; Pterygota (winged insects); Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Eremoneura; Cyclorrhapha; Schizophora; Acalyptratae; Ephydroidea; Drosophilidae (pomace flies); Drosophilinae; Drosophilini; Drosophila (fruit flies); Sophophora; melanogaster group; melanogaster subgroup; Drosophila melanogaster (Fruit fly) |
Subcellular Location | Secreted |
Developmental Stage | NA |
Similarity | Belongs to the TO family. |
Tissue Specificity | Expression is largely restricted to head; with limited expression detectable in cardia and crop. In entrained individuals; expression is observed in the brain cortex (region between optic lobe and cen |
Post Translational Modification | NA |
Function | Participates in a novel circadian output pathway that conveys temporal and food status information to feeding-relevant metabolisms and activities. Involved in male courtship behavior. In the brain-associated fat body; transcription is enhanced by the dsx and fru male-specific isoforms and repressed by the dsx female-specific isoform. |
Length | 249 |
Molecular Weight | 27 |
Name | Protein takeout |
Sequence | FPEDPKPCKYGDGECIMKLCNTLFSENSAEGDPGLNLMQLDPLKVDRMVISQGESSSPVGITLTFTDNLLYGIKDQRIVKVKGFGRDLTAKHEVKIVTKTFSLVGPYNIQGKVLILPISGTGQSNMTMVNVRAIVSFSGKPLVKNGETYLDVTDLKITMKPESSHYHFSNLFNGDKALGDNMNVFLNENSEAIYKETAKAIDRSFGKLYLGVVKGVFSKLPYAKFFADES |
Sequence map | 23-09 |
PDB ID | NA |
Drugpedia | NA |
Receptor | NA |
Domain | NA |
Pharmaceutical Use | NA
|