| Primary information |
|---|
| ID | 12769 |
| Uniprot ID | Q9JLV9 |
| Description | Prolactin-2C5 (Mitogen-regulated protein 4) |
| Organism | Mus musculus |
| Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Euarchontoglires; Glires (Rodents and rabbits); Rodentia; Myomorpha (mice and others); Muroidea; Muridae; Murinae; Mus; Mus; Mus musculus (Mouse) |
| Subcellular Location | Secreted |
| Developmental Stage | In placenta; detected at 8 dpc; peaks at 12 dpc and declines thereafter. |
| Similarity | Belongs to the somatotropin/prolactin family. |
| Tissue Specificity | Expressed in placenta (at protein level) (PubMed-10803597; PubMed-10537154; PubMed-16876275). Expressed in the tail hair follicle; with highest expression detected in the keratinocytes of the outer ro |
| Post Translational Modification | N-glycosylated and sialylated. |
| Function | NA |
| Length | 222 |
| Molecular Weight | 25 |
| Name | Prolactin-2C5 |
| Sequence | PMCAMRNDRCFMFFEDTFELAGSLSHNISIEVSELFTEFEKHYSNVPGLRDKSPMRCHTSFLPTPENKEQARHIRYEALLKSGDMILDAWENPLDYLVSELSTIKNVPDIIISKATDIKKKINAVQNGVNALMSTMNGDEENKNPAWFLQSDNEDARIRSSYGMISCLDNDFKKVDIYLNILKCYMLKIDNC |
| Sequence map | 33-42 |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | NA |
| Domain | NA |
| Pharmaceutical Use | NA
|