| Primary information |
|---|
| ID | 12766 |
| Uniprot ID | P05231 |
| Description | Interleukin-6 (IL-6) (B-cell stimulatory factor 2) (BSF-2) (CTL differentiation factor) (CDF) (Hybridoma growth factor) (Interferon beta-2) (IFN-beta-2) |
| Organism | Homo sapiens |
| Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Euarchontoglires; Primates; Haplorrhini; Simiiformes; Catarrhini; Hominoidea (apes); Hominidae (great apes); Homininae; Homo; Homo sapiens (Human) |
| Subcellular Location | Secreted |
| Developmental Stage | NA |
| Similarity | Belongs to the IL-6 superfamily. |
| Tissue Specificity | Produced by skeletal muscle. |
| Post Translational Modification | N- and O-glycosylated. |
| Function | Cytokine with a wide variety of biological functions in immunity; tissue regeneration; and metabolism. Binds to IL6R; then the complex associates to the signaling subunit IL6ST/gp130 to trigger the intracellular IL6-signaling pathway (Probable). The interaction with the membrane-bound IL6R and IL6ST stimulates 'classic signaling'; whereas the binding of IL6 and soluble IL6R to IL6ST stimulates 'trans-signaling'. Alternatively; 'cluster signaling' occurs when membrane-bound IL6-IL6R complexes on transmitter cells activate IL6ST receptors on neighboring receiver cells (Probable). |
| Length | 212 |
| Molecular Weight | 23 |
| Name | Interleukin-6 |
| Sequence | PPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM |
| Sequence map | 33-32 |
| PDB ID | 1ALU; 1IL6; 1N2Q; 1P9M; 2IL6; 4CNI; 4J4L; 4NI7; 4NI9; 4O9H; 4ZS7; 5FUC; 7NXZ; |
| Drugpedia | DB05767;DB05513;DB11967;DB05744;DB12140;DB10770;DB |
| Receptor | P11717; P08887 |
| Domain | NA |
| Pharmaceutical Use | NA
|