| Primary information |
|---|
| ID | 12765 |
| Uniprot ID | Q63264 |
| Description | Interleukin-1 beta (IL-1 beta) |
| Organism | Rattus norvegicus |
| Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Euarchontoglires; Glires (Rodents and rabbits); Rodentia; Myomorpha (mice and others); Muroidea; Muridae; Murinae; Rattus; Rattus norvegicus (Rat) |
| Subcellular Location | Cytoplasm; cytosol |
| Developmental Stage | NA |
| Similarity | Belongs to the IL-1 family. |
| Tissue Specificity | NA |
| Post Translational Modification | NA |
| Function | Potent proinflammatory cytokine. Initially discovered as the major endogenous pyrogen; induces prostaglandin synthesis; neutrophil influx and activation; T-cell activation and cytokine production; B-cell activation and antibody production; and fibroblast proliferation and collagen production. Promotes Th17 differentiation of T-cells. Synergizes with IL12/interleukin-12 to induce IFNG synthesis from T-helper 1 (Th1) cells. Plays a role in angiogenesis by inducing VEGF production synergistically with TNF and IL6. |
| Length | 268 |
| Molecular Weight | 30 |
| Name | Interleukin-1 beta |
| Sequence | PIRQLHCRLRDEQQKCLVLSDPCELKALHLNGQNISQQVVFSMSFVQGETSNDKIPVALGLKGLNLYLSCVMKDGTPTLQLESVDPKQYPKKKMEKRFVFNKIEVKTKVEFESAQFPNWYISTSQAEHRPVFLGNSNGRDIVDFTMEPVSS |
| Sequence map | 121-28 |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | NA |
| Domain | NA |
| Pharmaceutical Use | NA
|