| Primary information |
|---|
| ID | 12764 |
| Uniprot ID | Q9QUL0 |
| Description | Prolactin-3C1 (Decidualin) (Placental prolactin-like protein J) (PLP-J) (PRL-like protein J) (Prolactin-like protein I) (PLP-I) (PRL-like protein I) |
| Organism | Rattus norvegicus |
| Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Euarchontoglires; Glires (Rodents and rabbits); Rodentia; Myomorpha (mice and others); Muroidea; Muridae; Murinae; Rattus; Rattus norvegicus (Rat) |
| Subcellular Location | Secreted |
| Developmental Stage | Expression limited to early pregnancy with abundant expression on day 7; slightly declining expression on day 9; and no detectable expression by day 11. |
| Similarity | Belongs to the somatotropin/prolactin family. |
| Tissue Specificity | Expressed exclusively in decidual tissue. |
| Post Translational Modification | NA |
| Function | NA |
| Length | 211 |
| Molecular Weight | 24 |
| Name | Prolactin-3C1 |
| Sequence | PYDQMSNEELYDNLLSCSHRTHVVARKMYKILDLNVAERRCFKNKRNNTCHTTSTHTAKTNEDLLKVIISVSNAWIYPLKMLIPAVLTHLGSYDGMMARAIELNYGNQKILEGAKFLLSRIQPGIEENDYPVWSSLKELRSSNKSIHLFAFCKFFYCLRKDTKKIKDYLQILRPNIIKNKW |
| Sequence map | 33-31 |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | P05710 |
| Domain | NA |
| Pharmaceutical Use | NA
|