| Primary information |
|---|
| ID | 12763 |
| Uniprot ID | O08717 |
| Description | Inhibin beta E chain (Activin beta-E chain) |
| Organism | Mus musculus |
| Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Euarchontoglires; Glires (Rodents and rabbits); Rodentia; Myomorpha (mice and others); Muroidea; Muridae; Murinae; Mus; Mus; Mus musculus (Mouse) |
| Subcellular Location | Secreted |
| Developmental Stage | First expression in embryonic liver is detected at 17.5 dpc. |
| Similarity | Belongs to the TGF-beta family. |
| Tissue Specificity | NA |
| Post Translational Modification | NA |
| Function | Inhibins and activins inhibit and activate; respectively; the secretion of follitropin by the pituitary gland. Inhibins/activins are involved in regulating a number of diverse functions such as hypothalamic and pituitary hormone secretion; gonadal hormone secretion; germ cell development and maturation; erythroid differentiation; insulin secretion; nerve cell survival; embryonic axial development or bone growth; depending on their subunit composition. Inhibins appear to oppose the functions of activins. |
| Length | 350 |
| Molecular Weight | 39 |
| Name | Inhibin beta E chain |
| Sequence | PTCEPETPLCCRRDHYVDFQELGWRDWILQPEGYQLNYCSGQCPPHLAGSPGIAASFHSAVFSLLKANNPWPAGSSCCVPTARRPLSLLYLDHNGNVVKTDVPDMVVEACGCS |
| Sequence map | 242-50 |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | NA |
| Domain | NA |
| Pharmaceutical Use | NA
|