| Primary information |
|---|
| ID | 12761 |
| Uniprot ID | C0HLU6 |
| Description | Humanin-like protein (HNr) (Rattin) |
| Organism | Rattus norvegicus |
| Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Euarchontoglires; Glires (Rodents and rabbits); Rodentia; Myomorpha (mice and others); Muroidea; Muridae; Murinae; Rattus; Rattus norvegicus (Rat) |
| Subcellular Location | Mitochondrion |
| Developmental Stage | Levels decline with increasing age. |
| Similarity | NA |
| Tissue Specificity | In the testis; expressed in Leydig cells at 10; 20 and 60 days of age (at protein level) (PubMed-16619233). Also expressed in pachytene spermatocytes at day 20 and in vessels; peritubular cells and sp |
| Post Translational Modification | NA |
| Function | Plays a role as a neuroprotective factor |
| Length | 38 |
| Molecular Weight | 4 |
| Name | Humanin-like protein |
| Sequence | AKRGFNCLLLSISEIDLPVKRLESPNKTRRPYGASIY |
| Sequence map | 1-38 |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | NA |
| Domain | NA |
| Pharmaceutical Use | NA
|