| Primary information |
|---|
| ID | 12757 |
| Uniprot ID | Q5PXZ9 |
| Description | Metalloproteinase inhibitor 3 (Tissue inhibitor of metalloproteinases 3) (TIMP-3) |
| Organism | Macaca mulatta |
| Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Euarchontoglires; Primates; Haplorrhini; Simiiformes; Catarrhini; Cercopithecoidea; Cercopithecidae (Old World monkeys); Cercopithecinae; Macaca (macaques); Macaca mulatta (Rhesus macaque) |
| Subcellular Location | Secreted; extracellular space; extracellular matrix |
| Developmental Stage | NA |
| Similarity | Belongs to the protease inhibitor I35 (TIMP) family. |
| Tissue Specificity | NA |
| Post Translational Modification | NA |
| Function | Complexes with metalloproteinases (such as collagenases) and irreversibly inactivates them by binding to their catalytic zinc cofactor. May form part of a tissue-specific acute response to remodeling stimuli. Known to act on MMP-1; MMP-2; MMP-3; MMP-7; MMP-9; MMP-13; MMP-14 and MMP-15. |
| Length | 211 |
| Molecular Weight | 24 |
| Name | Metalloproteinase inhibitor 3 |
| Sequence | TCSPSHPQDAFCNSDIVIRAKVVGKKLVKEGPFGTLVYTIKQMKMYRGFTKMPHVQYIHTEASESLCGLKLEVNKYQYLLTGRVYDGKMYTGLCNFVERWDQLTLSQRKGLNYRYHLGCNCKIKSCYYLPCFVTSKNECLWTDMLSNFGYPGYQSKHYACIRQKGGYCSWYRGWAPPDKSIINATDP |
| Sequence map | 27-31 |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | NA |
| Domain | NA |
| Pharmaceutical Use | NA
|