Primary information |
---|
ID | 12754 |
Uniprot ID | P09320 |
Description | Prolactin-4A1 (Placental prolactin-like protein A) (PLP-A) (PRL-like protein A) |
Organism | Rattus norvegicus |
Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Euarchontoglires; Glires (Rodents and rabbits); Rodentia; Myomorpha (mice and others); Muroidea; Muridae; Murinae; Rattus; Rattus norvegicus (Rat) |
Subcellular Location | Secreted |
Developmental Stage | Expressed from days 14 to term of pregnancy. |
Similarity | Belongs to the somatotropin/prolactin family. |
Tissue Specificity | NA |
Post Translational Modification | NA |
Function | NA |
Length | 227 |
Molecular Weight | 26 |
Name | Prolactin-4A1 |
Sequence | RAKLLNVHNYTSYGDTWNQAIKISQDMNQYISDLSTHVKIFYAQGRGFERRTTRCHTSSLSSPENKEQAQQFQLEVLLGLSHSLLQAWLNPLHHLWAEMCDRLGSTPPTLYKALMLKESNIKLLDAIKNIAKKGNFEINEKANYTAWSELGFLQSPNRDTRYFAFYNLFHCLKKDSNNVEMYLKLLKCRLIRSKC |
Sequence map | 35-47 |
PDB ID | NA |
Drugpedia | NA |
Receptor | P05710 |
Domain | NA |
Pharmaceutical Use | NA
|