Primary information |
---|
ID | 12748 |
Uniprot ID | Q566B2 |
Description | Partner of bursicon (Bursicon subunit beta) |
Organism | Bombyx mori |
Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Protostomia; Ecdysozoa; Panarthropoda; Arthropoda; Mandibulata; Pancrustacea; Hexapoda; Insecta; Dicondylia; Pterygota (winged insects); Neoptera; Endopterygota; Amphiesmenoptera; Lepidoptera (butterflies and moths); Glossata; Neolepidoptera; Heteroneura; Ditrysia; Obtectomera; Bombycoidea (hawk-moths); Bombycidae (silkworm moths); Bombycinae; Bombyx; Bombyx mori (Silk moth) |
Subcellular Location | Secreted |
Developmental Stage | NA |
Similarity | NA |
Tissue Specificity | NA |
Post Translational Modification | NA |
Function | Final heterodimeric neurohormone released at the end of the molting cycle; involved in the sclerotization (tanning) of the insect cuticle; melanization and wing spreading. |
Length | 137 |
Molecular Weight | 15 |
Name | Partner of bursicon |
Sequence | ENCETVASEVHVTKEEYDEMGRLLRSCSGEVSVNKCEGMCNSQVHPSISSPTGFQKECFCCREKFLRERLVTLTHCYDPDGIRFEDEENALMEVRLREPDECECYKCGDFSR |
Sequence map | 27-17 |
PDB ID | NA |
Drugpedia | NA |
Receptor | NA |
Domain | NA |
Pharmaceutical Use | NA
|