| Primary information |
|---|
| ID | 12747 |
| Uniprot ID | A2VB90 |
| Description | Partner of bursicon (Bursicon subunit beta) (Single-chain bursicon) |
| Organism | Apis mellifera |
| Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Protostomia; Ecdysozoa; Panarthropoda; Arthropoda; Mandibulata; Pancrustacea; Hexapoda; Insecta; Dicondylia; Pterygota (winged insects); Neoptera; Endopterygota; Hymenoptera; Apocrita (wasps; ants; and bees); Aculeata; Apoidea (bees); Apidae (bumble bees and honey bees); Apinae (honey bees); Apini; Apis; Apis mellifera (Honeybee) |
| Subcellular Location | Secreted |
| Developmental Stage | NA |
| Similarity | NA |
| Tissue Specificity | NA |
| Post Translational Modification | NA |
| Function | Final heterodimeric neurohormone released at the end of the molting cycle; involved in the sclerotization (tanning) of the insect cuticle; melanization and wing spreading. |
| Length | 145 |
| Molecular Weight | 16 |
| Name | Partner of bursicon |
| Sequence | VTDDENCETLQSEVHITKDEYDEIGRLKRTCSGDISVTKCEGFCNSQVQPSVASTTGFSKECYCCRESYLKERHITLHHCYDADGIKLMNEENGVMEIKIREPVECKCIKCGDISQ |
| Sequence map | 31-25 |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | NA |
| Domain | NA |
| Pharmaceutical Use | NA
|