Primary information |
---|
ID | 12747 |
Uniprot ID | A2VB90 |
Description | Partner of bursicon (Bursicon subunit beta) (Single-chain bursicon) |
Organism | Apis mellifera |
Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Protostomia; Ecdysozoa; Panarthropoda; Arthropoda; Mandibulata; Pancrustacea; Hexapoda; Insecta; Dicondylia; Pterygota (winged insects); Neoptera; Endopterygota; Hymenoptera; Apocrita (wasps; ants; and bees); Aculeata; Apoidea (bees); Apidae (bumble bees and honey bees); Apinae (honey bees); Apini; Apis; Apis mellifera (Honeybee) |
Subcellular Location | Secreted |
Developmental Stage | NA |
Similarity | NA |
Tissue Specificity | NA |
Post Translational Modification | NA |
Function | Final heterodimeric neurohormone released at the end of the molting cycle; involved in the sclerotization (tanning) of the insect cuticle; melanization and wing spreading. |
Length | 145 |
Molecular Weight | 16 |
Name | Partner of bursicon |
Sequence | VTDDENCETLQSEVHITKDEYDEIGRLKRTCSGDISVTKCEGFCNSQVQPSVASTTGFSKECYCCRESYLKERHITLHHCYDADGIKLMNEENGVMEIKIREPVECKCIKCGDISQ |
Sequence map | 31-25 |
PDB ID | NA |
Drugpedia | NA |
Receptor | NA |
Domain | NA |
Pharmaceutical Use | NA
|