| Primary information |
|---|
| ID | 12743 |
| Uniprot ID | P20809 |
| Description | Interleukin-11 (IL-11) (Adipogenesis inhibitory factor) (AGIF) (Oprelvekin) |
| Organism | Homo sapiens |
| Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Euarchontoglires; Primates; Haplorrhini; Simiiformes; Catarrhini; Hominoidea (apes); Hominidae (great apes); Homininae; Homo; Homo sapiens (Human) |
| Subcellular Location | Secreted |
| Developmental Stage | NA |
| Similarity | Belongs to the IL-6 superfamily. |
| Tissue Specificity | NA |
| Post Translational Modification | NA |
| Function | Cytokine that stimulates the proliferation of hematopoietic stem cells and megakaryocyte progenitor cells and induces megakaryocyte maturation resulting in increased platelet production |
| Length | 199 |
| Molecular Weight | 21 |
| Name | Interleukin-11 |
| Sequence | GPPPGPPRVSPDPRAELDSTVLLTRSLLADTRQLAAQLRDKFPADGDHNLDSLPTLAMSAGALGALQLPGVLTRLRADLLSYLRHVQWLRRAGGSSLKTLEPELGTLQARLDRLLRRLQLLMSRLALPQPPPDPPAPPLAPPSSAWGGIRAAHAILGGLHLTLDWAVRGLLLLKTRL |
| Sequence map | 25-19 |
| PDB ID | 4MHL; 6O4O; |
| Drugpedia | NA |
| Receptor | Q14626 |
| Domain | NA |
| Pharmaceutical Use | Available under the name Neumega (Wyeth). Used for the prevention of severe thrombocytopenia and the reduction of the need for platelet transfusion following myelosuppressive chemotherapy.
|