| Primary information |
|---|
| ID | 12736 |
| Uniprot ID | P49763 |
| Description | Placenta growth factor (PlGF) |
| Organism | Homo sapiens |
| Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Euarchontoglires; Primates; Haplorrhini; Simiiformes; Catarrhini; Hominoidea (apes); Hominidae (great apes); Homininae; Homo; Homo sapiens (Human) |
| Subcellular Location | Secreted Note=The three isoforms are secreted but PlGF-2 appears to remain cell attached unless rele |
| Developmental Stage | NA |
| Similarity | Belongs to the PDGF/VEGF growth factor family. |
| Tissue Specificity | While the three isoforms are present in most placental tissues; PlGF-2 is specific to early (8 week) placenta and only PlGF-1 is found in the colon and mammary carcinomas. |
| Post Translational Modification | N-glycosylated. |
| Function | Growth factor active in angiogenesis and endothelial cell growth; stimulating their proliferation and migration. It binds to the receptor FLT1/VEGFR-1. Isoform PlGF-2 binds NRP1/neuropilin-1 and NRP2/neuropilin-2 in a heparin-dependent manner. Also promotes cell tumor growth. |
| Length | 221 |
| Molecular Weight | 24 |
| Name | Placenta growth factor |
| Sequence | PAVPPQQWALSAGNGSSEVEVVPFQEVWGRSYCRALERLVDVVSEYPSEVEHMFSPSCVSLLRCTGCCGDENLHCVPVETANVTMQLLKIRSGDRPSYVELTFSQHVRCECRHSPGRQSPDMPGDFRADAPSFLPPRRSLPMLFRMEWGCALTGSQSAVWPSSPVPEEIPRMHPGRNGKKQQRKPLREKMKPERCGDAVPRR |
| Sequence map | 22-41 |
| PDB ID | 1FZV; 1RV6; |
| Drugpedia | DB08885; |
| Receptor | P17948; P17948-2 |
| Domain | Isoform PlGF-2 contains a basic insert which acts |
| Pharmaceutical Use | NA
|