| Primary information |
|---|
| ID | 12733 |
| Uniprot ID | Q8C1Q4 |
| Description | Meteorin (Hypoxia/reoxygenation regulatory factor) |
| Organism | Mus musculus |
| Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Euarchontoglires; Glires (Rodents and rabbits); Rodentia; Myomorpha (mice and others); Muroidea; Muridae; Murinae; Mus; Mus; Mus musculus (Mouse) |
| Subcellular Location | Secreted |
| Developmental Stage | NA |
| Similarity | Belongs to the meteorin family. |
| Tissue Specificity | Highly expressed in brain. Expressed in undifferentiated neural progenitors and in astrocyte lineage; particulary in Bergmann glia; a subtype of radial glia; and a few discrete neuronal populations re |
| Post Translational Modification | NA |
| Function | Involved in both glial cell differentiation and axonal network formation during neurogenesis. Promotes astrocyte differentiation and transforms cerebellar astrocytes into radial glia. Also induces axonal extension in small and intermediate neurons of sensory ganglia by activating nearby satellite glia. |
| Length | 291 |
| Molecular Weight | 31 |
| Name | Meteorin |
| Sequence | YSEDRCSWRGSGLTQEPGSVGQLTLDCTEGAIEWLYPAGALRLTLGGPDPGTRPSIVCLRPERPFAGAQVFAERMTGNLELLLAEGPDLAGGRCMRWGPRERRALFLQATPHRDISRRVAAFRFELHEDQRAEMSPQAQGLGVDGACRPCSDAELLLAACTSDFVIHGTIHGVAHDTELQESVITVVVARVIRQTLPLFKEGSSEGQGRASIRTLLRCGVRPGPGSFLFMGWSRFGEAWLGCAPRFQEFSRVYSAALTTHLNPCEMALD |
| Sequence map | 26-51 |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | NA |
| Domain | NA |
| Pharmaceutical Use | NA
|