| Primary information |
|---|
| ID | 12730 |
| Uniprot ID | Q65Z15 |
| Description | Oncostatin-M (OSM) |
| Organism | Rattus norvegicus |
| Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Euarchontoglires; Glires (Rodents and rabbits); Rodentia; Myomorpha (mice and others); Muroidea; Muridae; Murinae; Rattus; Rattus norvegicus (Rat) |
| Subcellular Location | Secreted |
| Developmental Stage | NA |
| Similarity | Belongs to the LIF/OSM family. |
| Tissue Specificity | Widely expressed. Expressed at higher levels in liver; skin and spleen. |
| Post Translational Modification | Propeptide processing is not important for receptor binding activity but may be important growth-inhibitory activity. |
| Function | Growth regulator. Inhibits the proliferation of a number of tumor cell lines. It regulates cytokine production; including IL-6; G-CSF and GM-CSF from endothelial cells. Uses only type II OSM receptor (heterodimers composed of OSMR and IL6ST). Involved in the maturation of fetal hepatocytes; thereby promoting liver development and regeneration. |
| Length | 239 |
| Molecular Weight | 27 |
| Name | Oncostatin-M |
| Sequence | RGCSSSSPKLLSQLKSQANITGNTASLLEPYILHQNLNTLTLRAACTEHPVAFPSEDMLRQLSKPDFLSTVHATLGRVWHQLGAFRQQFPKIQDFPELERARQNIQGIRNNVYCMARLLHPPLEIPEPTQADSGTSRPTTTAPGIFQIKIDSCRFLWGYHRFMGSVGRVFEEWGDGSRRSRR |
| Sequence map | 29-28 |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | NA |
| Domain | NA |
| Pharmaceutical Use | NA
|