| Primary information |
|---|
| ID | 12729 |
| Uniprot ID | Q9QXU1 |
| Description | Male-specific submandibular salivary gland protein |
| Organism | Mesocricetus auratus |
| Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Euarchontoglires; Glires (Rodents and rabbits); Rodentia; Myomorpha (mice and others); Muroidea; Cricetidae; Cricetinae (hamsters); Mesocricetus; Mesocricetus auratus (Golden hamster) |
| Subcellular Location | Secreted |
| Developmental Stage | In the submandibular salivary gland; expression is very low in immature animals of both sexes with trace levels at 12 days of age. At 22 and 30 days of age; low levels occur in the submandibular saliv |
| Similarity | Belongs to the calycin superfamily. Lipocalin family. |
| Tissue Specificity | Expressed in acinar cells of the submandibular salivary gland from where it is secreted into saliva (at protein level) (PubMed-10561587; PubMed-8809199; PubMed-23453961). Also released from the subman |
| Post Translational Modification | N-glycosylated. |
| Function | NA |
| Length | 172 |
| Molecular Weight | 19 |
| Name | Male-specific submandibular salivary gland protein |
| Sequence | QHQNLEVSPSEVDGKWHSLYIAADNKSKVSEGGPLRVYVKHLECSDECQTFTIKFYTKVENVCQEHRVVGRKGKDGKYITDFSGQNYFHVVEKADDTMTFHNVNVDDSGKTNVILVVGKGESSSIEQKQRFEKTAEKYDIPKENIEHLVTTDTCNQ |
| Sequence map | 18-52 |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | NA |
| Domain | NA |
| Pharmaceutical Use | NA
|