Primary information |
---|
ID | 12725 |
Uniprot ID | P22618 |
Description | Insulin-like growth factor (IGF) (Fragment) |
Organism | Myxine glutinosa |
Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Cyclostomata (jawless vertebrates); Myxini; Myxiniformes; Myxinidae (hagfishes); Myxininae; Myxine; Myxine glutinosa (Atlantic hagfish) |
Subcellular Location | Secreted |
Developmental Stage | NA |
Similarity | Belongs to the insulin family. |
Tissue Specificity | NA |
Post Translational Modification | NA |
Function | The insulin-like growth factors; isolated from plasma; are structurally and functionally related to insulin but have a much higher growth-promoting activity. |
Length | 139 |
Molecular Weight | 16 |
Name | Insulin-like growth factor |
Sequence | SETLCGSELVDTLQFVCDDRGFFFVPQHVPPRRGAHRRSRARKGIVEECCFKGCSLRLLEMYCARPSKAERDVARPRQRPHRASQHSRRGSQSRGRGRSR |
Sequence map | 41-19 |
PDB ID | NA |
Drugpedia | NA |
Receptor | NA |
Domain | NA |
Pharmaceutical Use | NA
|