| Primary information |
|---|
| ID | 12725 |
| Uniprot ID | P22618 |
| Description | Insulin-like growth factor (IGF) (Fragment) |
| Organism | Myxine glutinosa |
| Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Cyclostomata (jawless vertebrates); Myxini; Myxiniformes; Myxinidae (hagfishes); Myxininae; Myxine; Myxine glutinosa (Atlantic hagfish) |
| Subcellular Location | Secreted |
| Developmental Stage | NA |
| Similarity | Belongs to the insulin family. |
| Tissue Specificity | NA |
| Post Translational Modification | NA |
| Function | The insulin-like growth factors; isolated from plasma; are structurally and functionally related to insulin but have a much higher growth-promoting activity. |
| Length | 139 |
| Molecular Weight | 16 |
| Name | Insulin-like growth factor |
| Sequence | SETLCGSELVDTLQFVCDDRGFFFVPQHVPPRRGAHRRSRARKGIVEECCFKGCSLRLLEMYCARPSKAERDVARPRQRPHRASQHSRRGSQSRGRGRSR |
| Sequence map | 41-19 |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | NA |
| Domain | NA |
| Pharmaceutical Use | NA
|