Primary information |
---|
ID | 12723 |
Uniprot ID | Q9CQ58 |
Description | Prolactin-8A9 (Placental prolactin-like protein C2) (PLP-C2) (PRL-like protein C2) (Prolactin-like protein C-beta) (PLP C-beta) |
Organism | Mus musculus |
Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Euarchontoglires; Glires (Rodents and rabbits); Rodentia; Myomorpha (mice and others); Muroidea; Muridae; Murinae; Mus; Mus; Mus musculus (Mouse) |
Subcellular Location | Secreted |
Developmental Stage | First detected at 11.5 dpc and expressed continually throughout development; its expression level fluctuated during gestation. |
Similarity | Belongs to the somatotropin/prolactin family. |
Tissue Specificity | Detected only in placenta. Localized to spongiotrophoblasts and trophoblast giant cells of the placenta. |
Post Translational Modification | NA |
Function | NA |
Length | 241 |
Molecular Weight | 27 |
Name | Prolactin-8A9 |
Sequence | PACMAQKSGCWNPLVETFNSAMQTAGTLRTLADQFYVELYHNQFSSGQFLIFNSNLIRRDETVARAGTYCHSTLSNPPDRGTEHADAETEKYLKTLINYVGAWIGPLYHVVIELNVMQDVPETILSKVRQIEENKRKLLEDLRWILTKVYPTAEMKEEFPAWEHLSFLKSQGKHYKLLAMFNLSNCIYNETYHILFYLRELKCQITGEDC |
Sequence map | 35-01 |
PDB ID | NA |
Drugpedia | NA |
Receptor | NA |
Domain | NA |
Pharmaceutical Use | NA
|