Primary information |
---|
ID | 12721 |
Uniprot ID | Q9DAY2 |
Description | Prolactin-8A6 (Placental prolactin-like protein C1) (PLP-C1) (PRL-like protein C1) (Prolactin-like protein C-alpha) (PLP C-alpha) (Prolactin-like protein C) |
Organism | Mus musculus |
Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Euarchontoglires; Glires (Rodents and rabbits); Rodentia; Myomorpha (mice and others); Muroidea; Muridae; Murinae; Mus; Mus; Mus musculus (Mouse) |
Subcellular Location | Secreted |
Developmental Stage | Expression increased from midgestation to the end of the pregnancy. |
Similarity | Belongs to the somatotropin/prolactin family. |
Tissue Specificity | Expressed specifically in the spongiotrophoblast and trophoblast giant cells from the junctional zone of the chorioallantoic placenta. |
Post Translational Modification | NA |
Function | NA |
Length | 240 |
Molecular Weight | 27 |
Name | Prolactin-8A6 |
Sequence | LPCVAEEGGCWNPLLETFNSATQKAETLHNLADQLYVELYYNQFSSGQFWDFSSQIIRQDKTVVRAGSYCHSSLTNPPNTGVHINIEIASYLKTLINFVGSWISPLFHLVIELSATKDVPETILSKAKEIEENNRQILSDLRWILTKVSPAAEMTEEFPHWEYLSFLKSSDKNNKFLAMFNLSYCIDHDSKYILLQLRLLKCLITGKDC |
Sequence map | 35 |
PDB ID | NA |
Drugpedia | NA |
Receptor | NA |
Domain | NA |
Pharmaceutical Use | NA
|