Primary information |
---|
ID | 12716 |
Uniprot ID | Q9R006 |
Description | Prolactin-7A2 (Placental prolactin-like protein F) (PLP-F) (PRL-like protein F) |
Organism | Rattus norvegicus |
Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Euarchontoglires; Glires (Rodents and rabbits); Rodentia; Myomorpha (mice and others); Muroidea; Muridae; Murinae; Rattus; Rattus norvegicus (Rat) |
Subcellular Location | Secreted |
Developmental Stage | NA |
Similarity | Belongs to the somatotropin/prolactin family. |
Tissue Specificity | Expression restricted to placental tissues. Trophoblast giant cells are found to be the major source. |
Post Translational Modification | NA |
Function | NA |
Length | 250 |
Molecular Weight | 28 |
Name | Prolactin-7A2 |
Sequence | NLNSNETDGDLLLHRGLFDTATRLSQDIRDLDIEFLRMYAVNEVSEKLYNKHMLEFIEDMDFVVKALTCCHNYSIKTPENLDEAQQIPFNDFPWLILSRMWGWNETSKNLLTILRSIPGMHDDVISLAQAIERKLAELFEYTQSILTLIFGPTENVDRSIFSGLEDLKASDEELRFFALCKFSYCLRVDLQTIELYFKLLQCAVNVNSNVCLSINSEDSS |
Sequence map | 34-10 |
PDB ID | NA |
Drugpedia | NA |
Receptor | P05710 |
Domain | NA |
Pharmaceutical Use | NA
|