| Primary information |
|---|
| ID | 12716 |
| Uniprot ID | Q9R006 |
| Description | Prolactin-7A2 (Placental prolactin-like protein F) (PLP-F) (PRL-like protein F) |
| Organism | Rattus norvegicus |
| Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Euarchontoglires; Glires (Rodents and rabbits); Rodentia; Myomorpha (mice and others); Muroidea; Muridae; Murinae; Rattus; Rattus norvegicus (Rat) |
| Subcellular Location | Secreted |
| Developmental Stage | NA |
| Similarity | Belongs to the somatotropin/prolactin family. |
| Tissue Specificity | Expression restricted to placental tissues. Trophoblast giant cells are found to be the major source. |
| Post Translational Modification | NA |
| Function | NA |
| Length | 250 |
| Molecular Weight | 28 |
| Name | Prolactin-7A2 |
| Sequence | NLNSNETDGDLLLHRGLFDTATRLSQDIRDLDIEFLRMYAVNEVSEKLYNKHMLEFIEDMDFVVKALTCCHNYSIKTPENLDEAQQIPFNDFPWLILSRMWGWNETSKNLLTILRSIPGMHDDVISLAQAIERKLAELFEYTQSILTLIFGPTENVDRSIFSGLEDLKASDEELRFFALCKFSYCLRVDLQTIELYFKLLQCAVNVNSNVCLSINSEDSS |
| Sequence map | 34-10 |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | P05710 |
| Domain | NA |
| Pharmaceutical Use | NA
|