| Primary information |
|---|
| ID | 12711 |
| Uniprot ID | P28491 |
| Description | Calreticulin (CRP55) (Calregulin) (Endoplasmic reticulum resident protein 60) (ERp60) (HACBP) |
| Organism | Sus scrofa |
| Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Laurasiatheria; Artiodactyla; Suina; Suidae (pigs); Sus; Sus scrofa (Pig) |
| Subcellular Location | Endoplasmic reticulum lumen |
| Developmental Stage | Expressed in immature GV-stage oocytes; mature MII-stage oocytes; parthenogenetically activated MII-stage oocytes and in pronuclear embryos (at protein level). During in vitro oocyte maturation; expre |
| Similarity | Belongs to the calreticulin family. |
| Tissue Specificity | In blastocyst expressed in all blastomeres (at protein level). In embryos; expressed in spleen; kidney; liver; fat; muscle; ovary; granulosa cells and cumulus cells. |
| Post Translational Modification | NA |
| Function | Calcium-binding chaperone that promotes folding; oligomeric assembly and quality control in the endoplasmic reticulum (ER) via the calreticulin/calnexin cycle. This lectin interacts transiently with almost all of the monoglucosylated glycoproteins that are synthesized in the ER. Interacts with the DNA-binding domain of NR3C1 and mediates its nuclear export. Involved in maternal gene expression regulation. May participate in oocyte maturation via the regulation of calcium homeostasis |
| Length | 417 |
| Molecular Weight | 48 |
| Name | Calreticulin |
| Sequence | PTIYFKEQFLDGDGWTDRWIESKHKPDFGRFVLSSGKFYGDQEKDKGLQTSQDARFYALSARFEPFSNKGQTLVVQFTVKHEQNIDCGGGYVKLFPDGLDQTDMHGDSEYNIMFGPDICGPGTKKVHVIFNYKGKNVLINKDIRCKDDEFTHLYTLIVRPDNTYEVKIDNSQVESGSLEDDWDFLPPKKIKDPDAVKPEDWDERAKIDDPTDSKPEDWDKPEHIPDPDAKKPEDWDEEMDGEWEPPVIQNPEYKGEWKPRQIDNPDYKGTWIHPEIDNPEYSPDSNIYAYENFAVLGLDLWQVKSGTIFDNFLITNDEAYAEEFGNETWGVTKAAEKQMKDKQDEEQRLKEEEEEKKRKEEEEVDKEDEEDKDEDEEEEDEKEEEEEEDAAAGQAKDEL |
| Sequence map | 24-57 |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | NA |
| Domain | Can be divided into a N-terminal globular domain; |
| Pharmaceutical Use | NA
|