Primary information |
---|
ID | 12711 |
Uniprot ID | P28491 |
Description | Calreticulin (CRP55) (Calregulin) (Endoplasmic reticulum resident protein 60) (ERp60) (HACBP) |
Organism | Sus scrofa |
Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Laurasiatheria; Artiodactyla; Suina; Suidae (pigs); Sus; Sus scrofa (Pig) |
Subcellular Location | Endoplasmic reticulum lumen |
Developmental Stage | Expressed in immature GV-stage oocytes; mature MII-stage oocytes; parthenogenetically activated MII-stage oocytes and in pronuclear embryos (at protein level). During in vitro oocyte maturation; expre |
Similarity | Belongs to the calreticulin family. |
Tissue Specificity | In blastocyst expressed in all blastomeres (at protein level). In embryos; expressed in spleen; kidney; liver; fat; muscle; ovary; granulosa cells and cumulus cells. |
Post Translational Modification | NA |
Function | Calcium-binding chaperone that promotes folding; oligomeric assembly and quality control in the endoplasmic reticulum (ER) via the calreticulin/calnexin cycle. This lectin interacts transiently with almost all of the monoglucosylated glycoproteins that are synthesized in the ER. Interacts with the DNA-binding domain of NR3C1 and mediates its nuclear export. Involved in maternal gene expression regulation. May participate in oocyte maturation via the regulation of calcium homeostasis |
Length | 417 |
Molecular Weight | 48 |
Name | Calreticulin |
Sequence | PTIYFKEQFLDGDGWTDRWIESKHKPDFGRFVLSSGKFYGDQEKDKGLQTSQDARFYALSARFEPFSNKGQTLVVQFTVKHEQNIDCGGGYVKLFPDGLDQTDMHGDSEYNIMFGPDICGPGTKKVHVIFNYKGKNVLINKDIRCKDDEFTHLYTLIVRPDNTYEVKIDNSQVESGSLEDDWDFLPPKKIKDPDAVKPEDWDERAKIDDPTDSKPEDWDKPEHIPDPDAKKPEDWDEEMDGEWEPPVIQNPEYKGEWKPRQIDNPDYKGTWIHPEIDNPEYSPDSNIYAYENFAVLGLDLWQVKSGTIFDNFLITNDEAYAEEFGNETWGVTKAAEKQMKDKQDEEQRLKEEEEEKKRKEEEEVDKEDEEDKDEDEEEEDEKEEEEEEDAAAGQAKDEL |
Sequence map | 24-57 |
PDB ID | NA |
Drugpedia | NA |
Receptor | NA |
Domain | Can be divided into a N-terminal globular domain; |
Pharmaceutical Use | NA
|