Primary information |
---|
ID | 12710 |
Uniprot ID | Q9TU09 |
Description | Leptin (Obesity factor) (Fragment) |
Organism | Equus caballus |
Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Laurasiatheria; Perissodactyla (odd-toed ungulates); Equidae (horses); Equus; Equus; Equus caballus (Horse) |
Subcellular Location | Secreted |
Developmental Stage | NA |
Similarity | Belongs to the leptin family. |
Tissue Specificity | NA |
Post Translational Modification | NA |
Function | Key player in the regulation of energy balance and body weight control. Once released into the circulation; has central and peripheral effects by binding LEPR; found in many tissues; which results in the activation of several major signaling pathways. In the hypothalamus; acts as an appetite-regulating factor that induces a decrease in food intake and an increase in energy consumption by inducing anorexinogenic factors and suppressing orexigenic neuropeptides; also regulates bone mass and secretion of hypothalamo-pituitary-adrenal hormones. In the periphery; increases basal metabolism; influences reproductive function; regulates pancreatic beta-cell function and insulin secretion; is pro-angiogenic for endothelial cell and affects innate and adaptive immunity. In the arcuate nucleus of the hypothalamus; activates by depolarization POMC neurons inducing FOS and SOCS3 expression to release anorexigenic peptides and inhibits by hyperpolarization NPY neurons inducing SOCS3 with a consequen |
Length | 145 |
Molecular Weight | 15 |
Name | Leptin |
Sequence | PIRKVQDDTKTLIKTIVTRINDISHTQSVSSKQRVTGLDFIPGLHPVLSLSKMDQTLAIYQQILTSLPSRNVIQISNDLENLRDLLHLLASSKSCPLPQARGLETLASLGGVLEASLLLHRGGSPEQAAGVS |
Sequence map | 15-25 |
PDB ID | NA |
Drugpedia | NA |
Receptor | NA |
Domain | NA |
Pharmaceutical Use | NA
|