| Primary information |
|---|
| ID | 12696 |
| Uniprot ID | Q9VJS7 |
| Description | Partner of bursicon (Bursicon subunit beta) |
| Organism | Drosophila melanogaster |
| Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Protostomia; Ecdysozoa; Panarthropoda; Arthropoda; Mandibulata; Pancrustacea; Hexapoda; Insecta; Dicondylia; Pterygota (winged insects); Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Eremoneura; Cyclorrhapha; Schizophora; Acalyptratae; Ephydroidea; Drosophilidae (pomace flies); Drosophilinae; Drosophilini; Drosophila (fruit flies); Sophophora; melanogaster group; melanogaster subgroup; Drosophila melanogaster (Fruit fly) |
| Subcellular Location | Secreted |
| Developmental Stage | Expression is low in larval stages and increases before ecdysis; consistent with role in postecdysial cuticle changes. |
| Similarity | NA |
| Tissue Specificity | Coexpressed with CCAP in most CCAP-specific neurons. Coexpressed with Burs in 4 bilateral neurons in thoracic and abdominal neuromeres of the ventral nervous system. |
| Post Translational Modification | NA |
| Function | Final heterodimeric neurohormone released at the end of the molting cycle; involved in the sclerotization (tanning) of the insect cuticle; melanization and wing spreading. Heterodimer specifically activates the G protein-coupled receptor rk. |
| Length | 141 |
| Molecular Weight | 16 |
| Name | Partner of bursicon |
| Sequence | RYSQGTGDENCETLKSEIHLIKEEFDELGRMQRTCNADVIVNKCEGLCNSQVQPSVITPTGFLKECYCCRESFLKEKVITLTHCYDPDGTRLTSPEMGSMDIRLREPTECKCFKCGDFTR |
| Sequence map | 23-21 |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | NA |
| Domain | NA |
| Pharmaceutical Use | NA
|