| Primary information |
|---|
| ID | 12687 |
| Uniprot ID | Q8C119 |
| Description | Protein NDNF (Epidermacan) (Neuron-derived neurotrophic factor) |
| Organism | Mus musculus |
| Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Euarchontoglires; Glires (Rodents and rabbits); Rodentia; Myomorpha (mice and others); Muroidea; Muridae; Murinae; Mus; Mus; Mus musculus (Mouse) |
| Subcellular Location | Secreted |
| Developmental Stage | At 16.5 dpc; specifically expressed in the interfollicular basal cells of the epidermis (at protein level). Detected in the marginal cells and cortical plate of the brain cortex from 16 dpc to P90 wit |
| Similarity | NA |
| Tissue Specificity | Expressed in brain and spinal cord with no expression detected in heart; kidney or liver. Expressed by neurons but not by astrocytes. In the brain; detected in the cerebrum; cerebellum and olfactory b |
| Post Translational Modification | O-glycosylated; contains heparan sulfate and chondroitin sulfate. |
| Function | Secretory protein that plays a role in various cellular processes. Acts as a chemorepellent acting on gonadotropin-releasing hormone (GnRH) expressing neurons regulating their migration to the hypothalamus |
| Length | 568 |
| Molecular Weight | 65 |
| Name | Protein NDNF |
| Sequence | KLPTRDEELFQMQIRDKEFFHDSSVIPDGAEVSSYLFRDTPRRYFFMVEEDNTPLSVTVTPCDAPLEWKLSLQELHEGSSADGSGDPELLDQQKQQMTDVEGTELFSYKGNDVEYFLSSSSPSGLYQLELLSTEKDTHFKVYATTTPESDQPYPELPYDPRVDVTSFGRTTVTLAWKPSPTASILKQPIEYCVVINKEHNFKSLCAAETKMNADDAFMVAPKPGLDFNPFDFAHFGFPTDNLGKDRSLLAKPSPKVGRHVYWRPKVDIQKICIGNKNIFTVSDLKPDTQYYFDVFMVNTNTNMSTAYVGAFVRTKEEAKQKTVELKDGRVTDVFVKRKGKKFLRFAPVSSHQKVTFFIHSCMDAVQVQVRRDGRLLLSQNVEGIRQFQLRGKPKGKYLIRLKGNRKGASKLKILATTRPSKHAFPSLPEDTRIKAFDKLRTCSSVTVAWLGTQERRKFCIYRKEVDGNYSEDQKRREQNQCLGPDTRKKSEKVLCKYFHSQNLQKAVTTETIRDLQPGKSYLLDVYVVGHGGHSVKYQSKIVKTRKVC |
| Sequence map | 29-28 |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | NA |
| Domain | NA |
| Pharmaceutical Use | NA
|