| Primary information |
|---|
| ID | 12685 |
| Uniprot ID | Q9PTH3 |
| Description | Insulin-like growth factor-binding protein 2-A (IGF-binding protein 2-A) (IGFBP-2-A) (IGFBP-2a) |
| Organism | Danio rerio |
| Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Actinopterygii; Actinopteri; Neopterygii; Teleostei; Osteoglossocephalai; Clupeocephala; Otomorpha; Ostariophysi; Otophysi; Cypriniphysae; Cypriniformes (carps and others); Cyprinoidei; Danionidae; Danioninae; Danio; Danio rerio (Zebrafish) (Brachydanio rerio) |
| Subcellular Location | Secreted |
| Developmental Stage | Not expressed until 10 hpf. Expression gradually increases from 10 to 36 hpf and is maintained at high levels thereafter. |
| Similarity | NA |
| Tissue Specificity | In embryos at 24 hpf; initially expressed in the lens and cranial region; and at 48 and 72 hpf in the brain boundary vasculature. Expression in these regions persists throughout the hatching period an |
| Post Translational Modification | NA |
| Function | IGF-binding proteins prolong the half-life of the IGFs and have been shown to either inhibit or stimulate the growth promoting effects of the IGFs on cell culture. They alter the interaction of IGFs with their cell surface receptors. |
| Length | 276 |
| Molecular Weight | 30 |
| Name | Insulin-like growth factor-binding protein 2-A |
| Sequence | MVFRCPSCTAERQAACPMLTETCGEIVREPGCGCCPVCARQEGEQCGVYTPRCSSGLRCYPKPDSELPLELLVQGLGRCGRKVDTEPTGSAEPREVSGEVQDPLDIGLTEVPPIRKPTKDSPWKESAVLQHRQQLKSKMKYHKVEDPKAPHAKQSQCQQELDQVLERISKITFKDNRTPLEDLYSLHIPNCDKRGQYNLKQCKMSVNGYRGECWCVNPHTGRPMPTSPLIRGDPNCNQYLDGQEMDPSVDPPN |
| Sequence map | 27-36 |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | NA |
| Domain | NA |
| Pharmaceutical Use | NA
|