| Primary information |
|---|
| ID | 12666 |
| Uniprot ID | P80703 |
| Description | Apolipophorin-3 (Apolipophorin-III) (ApoLp-III) |
| Organism | Galleria mellonella |
| Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Protostomia; Ecdysozoa; Panarthropoda; Arthropoda; Mandibulata; Pancrustacea; Hexapoda; Insecta; Dicondylia; Pterygota (winged insects); Neoptera; Endopterygota; Amphiesmenoptera; Lepidoptera (butterflies and moths); Glossata; Neolepidoptera; Heteroneura; Ditrysia; Obtectomera; Pyraloidea; Pyralidae (snout moths); Galleriinae; Galleria; Galleria mellonella (Greater wax moth) |
| Subcellular Location | Secreted |
| Developmental Stage | NA |
| Similarity | Belongs to the insect apolipophorin-3 family. |
| Tissue Specificity | Expressed in hemolymph (PubMed-17194500; PubMed-29289504). Also found in hemocytes and fat body (PubMed-29289504). |
| Post Translational Modification | NA |
| Function | Assists in the loading of diacylglycerol; generated from triacylglycerol stores in the fat body through the action of adipokinetic hormone; into lipophorin; the hemolymph lipoprotein. It increases the lipid carrying capacity of lipophorin by covering the expanding hydrophobic surface resulting from diacylglycerol uptake. It thus plays a critical role in the transport of lipids during flight in several species of insects. Has antibacterial activity against the Gram-positive bacteria L.monocytogenes (MIC=6.5 uM). Lacks antibacterial activity against the Gram-positive bacteria B.circulans; M.luteus; S.aureus; and S.lutea; and the Gram-negative bacteria E.coli D31; E.coli ATCC 25922; and S.typhimurium. Lacks antifungal activity against S.cerevisiae; P.pastoris; Z.marxianus; C.albicans; C.wickerhamii; A.niger; F.oxysporum; and T.harizianum. |
| Length | 186 |
| Molecular Weight | 20 |
| Name | Apolipophorin-3 |
| Sequence | ASTPLQDLEKHAAEFQKTFSEQLNAFTNSKDTKEFNTALKEGSDSVLQQLNALASSLQKALNDANGKAKEALEQTRTNLERTAEELRRAHPDVERQAGALRDRLQTAVQATVQETQKLAKTVGANLEETNKKLAPQIKSAYDDFVKQAQEVQKKLHEAASKQ |
| Sequence map | 27-06 |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | NA |
| Domain | NA |
| Pharmaceutical Use | NA
|