Primary information |
---|
ID | 12666 |
Uniprot ID | P80703 |
Description | Apolipophorin-3 (Apolipophorin-III) (ApoLp-III) |
Organism | Galleria mellonella |
Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Protostomia; Ecdysozoa; Panarthropoda; Arthropoda; Mandibulata; Pancrustacea; Hexapoda; Insecta; Dicondylia; Pterygota (winged insects); Neoptera; Endopterygota; Amphiesmenoptera; Lepidoptera (butterflies and moths); Glossata; Neolepidoptera; Heteroneura; Ditrysia; Obtectomera; Pyraloidea; Pyralidae (snout moths); Galleriinae; Galleria; Galleria mellonella (Greater wax moth) |
Subcellular Location | Secreted |
Developmental Stage | NA |
Similarity | Belongs to the insect apolipophorin-3 family. |
Tissue Specificity | Expressed in hemolymph (PubMed-17194500; PubMed-29289504). Also found in hemocytes and fat body (PubMed-29289504). |
Post Translational Modification | NA |
Function | Assists in the loading of diacylglycerol; generated from triacylglycerol stores in the fat body through the action of adipokinetic hormone; into lipophorin; the hemolymph lipoprotein. It increases the lipid carrying capacity of lipophorin by covering the expanding hydrophobic surface resulting from diacylglycerol uptake. It thus plays a critical role in the transport of lipids during flight in several species of insects. Has antibacterial activity against the Gram-positive bacteria L.monocytogenes (MIC=6.5 uM). Lacks antibacterial activity against the Gram-positive bacteria B.circulans; M.luteus; S.aureus; and S.lutea; and the Gram-negative bacteria E.coli D31; E.coli ATCC 25922; and S.typhimurium. Lacks antifungal activity against S.cerevisiae; P.pastoris; Z.marxianus; C.albicans; C.wickerhamii; A.niger; F.oxysporum; and T.harizianum. |
Length | 186 |
Molecular Weight | 20 |
Name | Apolipophorin-3 |
Sequence | ASTPLQDLEKHAAEFQKTFSEQLNAFTNSKDTKEFNTALKEGSDSVLQQLNALASSLQKALNDANGKAKEALEQTRTNLERTAEELRRAHPDVERQAGALRDRLQTAVQATVQETQKLAKTVGANLEETNKKLAPQIKSAYDDFVKQAQEVQKKLHEAASKQ |
Sequence map | 27-06 |
PDB ID | NA |
Drugpedia | NA |
Receptor | NA |
Domain | NA |
Pharmaceutical Use | NA
|