| Primary information |
|---|
| ID | 12660 |
| Uniprot ID | Q6H8S9 |
| Description | Erythropoietin |
| Organism | Nannospalax galili |
| Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Euarchontoglires; Glires (Rodents and rabbits); Rodentia; Myomorpha (mice and others); Muroidea; Spalacidae; Spalacinae (blind mole-rats); Nannospalax (Mediterranean blind mole-rats); Nannospalax galili (Northern Israeli blind subterran |
| Subcellular Location | Secreted |
| Developmental Stage | NA |
| Similarity | Belongs to the EPO/TPO family. |
| Tissue Specificity | NA |
| Post Translational Modification | NA |
| Function | Hormone involved in the regulation of erythrocyte proliferation and differentiation and the maintenance of a physiological level of circulating erythrocyte mass. Binds to EPOR leading to EPOR dimerization and JAK2 activation thereby activating specific downstream effectors; including STAT1 and STAT3. |
| Length | 192 |
| Molecular Weight | 21 |
| Name | Erythropoietin |
| Sequence | PPRLICDSRVLERYILEAKEAENITMGCAEGPRFNENFTVPDTKVNFYAWKTMGVEEQAVEVWQGLSLLFEAILRAQAVLANSSQPSEMLQLHVDKAISGLRSLTSLLRALGAQKEAISPPDTTQVIPLRRFTVDTFCKLFRIYSNFLRGKLKLYTGEACRRGDR |
| Sequence map | 30-12 |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | NA |
| Domain | NA |
| Pharmaceutical Use | NA
|