| Primary information |
|---|
| ID | 12657 |
| Uniprot ID | A1L2K1 |
| Description | Meteorin-like protein |
| Organism | Xenopus laevis |
| Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amphibia; Batrachia; Anura; Pipoidea; Pipidae; Xenopodinae; Xenopus; Xenopus; Xenopus laevis (African clawed frog) |
| Subcellular Location | Secreted |
| Developmental Stage | NA |
| Similarity | Belongs to the meteorin family. |
| Tissue Specificity | NA |
| Post Translational Modification | NA |
| Function | Hormone induced following exercise or cold exposure that promotes energy expenditure. Induced either in the skeletal muscle after exercise or in adipose tissue following cold exposure and is present in the circulation. Able to stimulate energy expenditure associated with the browning of the white fat depots and improves glucose tolerance. |
| Length | 286 |
| Molecular Weight | 32 |
| Name | Meteorin-like protein |
| Sequence | LYSSDMCNWKGSGLTHEGHTKDVEQVYLRCSEGSVEWLYPTGAMVINLRPNTLTSAYKHLTVCIKPFKDSKGANIYSEKTGELKLVVPDGENNPHKVYCFGLDRGGLYIEATPQQDISRKITGFQYELISQRTLSDLHTVSDPCRPCSDTEVLLAVCISDFVVKGTISAVTNDEELQESLINVTVDKLYRQKSKIFLPKDNGGWEGMIRTPLECGVKTGMGSFLFTGRMHFGEPRLGCTPRYKDFKRIYLEAKKQGLNPCEISTD |
| Sequence map | 25-46 |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | NA |
| Domain | NA |
| Pharmaceutical Use | NA
|