Primary information |
---|
ID | 12653 |
Uniprot ID | G7PWZ3 |
Description | Growth/differentiation factor 15 (GDF-15) (Macrophage inhibitory cytokine 1) (MIC-1) |
Organism | Macaca fascicularis |
Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Euarchontoglires; Primates; Haplorrhini; Simiiformes; Catarrhini; Cercopithecoidea; Cercopithecidae (Old World monkeys); Cercopithecinae; Macaca (macaques); Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey) |
Subcellular Location | Secreted |
Developmental Stage | NA |
Similarity | Belongs to the TGF-beta family. |
Tissue Specificity | Detected in plasma (at protein level). |
Post Translational Modification | NA |
Function | Regulates food intake; energy expenditure and body weight in response to metabolic and toxin-induced stresses. Binds to its receptor; GFRAL; and activates GFRAL-expressing neurons localized in the area postrema and nucleus tractus solitarius of the brainstem. It then triggers the activation of neurons localized within the parabrachial nucleus and central amygdala; which constitutes part of the 'emergency circuit' that shapes feeding responses to stressful conditions |
Length | 308 |
Molecular Weight | 34 |
Name | Growth/differentiation factor 15 |
Sequence | RARARNGDRCPLGPGRCCRLHTVHASLEDLGWADWVLSPREVQVTMCIGACPSQFREANMHAQIKMNLHRLKPDTVPAPCCVPASYNPMVLIQKTDTGVSLQTYDDLLAKDCHCV |
Sequence map | 198-08 |
PDB ID | NA |
Drugpedia | NA |
Receptor | NA |
Domain | NA |
Pharmaceutical Use | NA
|