| Primary information |
|---|
| ID | 12652 |
| Uniprot ID | P20003 |
| Description | Fibroblast growth factor 2 (FGF-2) (Basic fibroblast growth factor) (bFGF) (Heparin-binding growth factor 2) (HBGF-2) |
| Organism | Ovis aries |
| Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Laurasiatheria; Artiodactyla; Ruminantia; Pecora; Bovidae; Caprinae; Ovis; Ovis aries (Sheep) |
| Subcellular Location | Secreted |
| Developmental Stage | NA |
| Similarity | Belongs to the heparin-binding growth factors family. |
| Tissue Specificity | NA |
| Post Translational Modification | Phosphorylation at Tyr-82 regulates FGF2 unconventional secretion. |
| Function | Acts as a ligand for FGFR1; FGFR2; FGFR3 and FGFR4. Also acts as an integrin ligand which is required for FGF2 signaling. Binds to integrin ITGAV-ITGB3. Plays an important role in the regulation of cell survival; cell division; cell differentiation and cell migration. Functions as a potent mitogen in vitro. Can induce angiogenesis. Mediates phosphorylation of ERK1/2 and thereby promotes retinal lens fiber differentiation. |
| Length | 155 |
| Molecular Weight | 17 |
| Name | Fibroblast growth factor 2 |
| Sequence | ALPEDGGSSAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHIKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERLESNNYNTYRSRKYSSWYVALKRTGQYKLGPKTGPGQKAILFLPMSAKS |
| Sequence map | 12-35 |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | NA |
| Domain | NA |
| Pharmaceutical Use | NA
|