| Primary information |
|---|
| ID | 12638 |
| Uniprot ID | Q64299 |
| Description | CCN family member 3 (Cellular communication network factor 3) (Nephroblastoma-overexpressed gene protein homolog) (Protein NOV homolog) (NovH) |
| Organism | Mus musculus |
| Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Euarchontoglires; Glires (Rodents and rabbits); Rodentia; Myomorpha (mice and others); Muroidea; Muridae; Murinae; Mus; Mus; Mus musculus (Mouse) |
| Subcellular Location | Secreted |
| Developmental Stage | Up-regulated in the early phase of bone regeneration. |
| Similarity | Belongs to the CCN family. |
| Tissue Specificity | Expressed in large vessels including the ascending aorta; carotid arteries; and the thoracic aorta; in medium-sized vessels such as coronary arteries and small pulmonary veins and also in small vessel |
| Post Translational Modification | May be palmitoylated on Cys-241; which is important for extracellular secretion. |
| Function | Immediate-early protein playing a role in various cellular processes including proliferation; adhesion; migration; differentiation and survival. Acts by binding to integrins or membrane receptors such as NOTCH1. Essential regulator of hematopoietic stem and progenitor cell function. Inhibits myogenic differentiation through the activation of Notch-signaling pathway. Inhibits vascular smooth muscle cells proliferation by increasing expression of cell-cycle regulators such as CDKN2B or CDKN1A independently of TGFB1 signaling. Ligand of integrins ITGAV-ITGB3 and ITGA5-ITGB1; acts directly upon endothelial cells to stimulate pro-angiogenic activities and induces angiogenesis. In endothelial cells; supports cell adhesion; induces directed cell migration (chemotaxis) and promotes cell survival. Plays also a role in cutaneous wound healing acting as integrin receptor ligand. Supports skin fibroblast adhesion through ITGA5-ITGB1 and ITGA6-ITGB1 and induces fibroblast chemotaxis through ITGAV-I |
| Length | 354 |
| Molecular Weight | 38 |
| Name | CCN family member 3 |
| Sequence | VSASLRCPSRCPPKCPSISPTCAPGVRSVLDGCSCCPVCARQRGESCSEMRPCDQSSGLYCDRSADPNNQTGICMVPEGDNCVFDGVIYRNGEKFEPNCQYFCTCRDGQIGCLPRCQLDVLLPGPDCPAPRKVAVPGECCEKWTCGSDEQGTQGTLGGLALPAYRPEATVGVEVSDSSINCIEQTTEWSACSKSCGMGVSTRVTNRNRQCEMVKQTRLCIVRPCEQEPEEVTDKKGKKCLRTKKSLKAIHLQFENCTSLYTYKPRFCGVCSDGRCCTPHNTKTIQVEFQCLPGEIIKKPVMVIGTCTCYSNCPQNNEAFLQDLELKTSRGEI |
| Sequence map | 27-54 |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | NA |
| Domain | NA |
| Pharmaceutical Use | NA
|