| Primary information |
|---|
| ID | 12633 |
| Uniprot ID | Q11005 |
| Description | Stromelysin-3 (ST3) (EC 3.4.24.-) (Matrix metalloproteinase-11) (MMP-11) |
| Organism | Xenopus laevis |
| Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amphibia; Batrachia; Anura; Pipoidea; Pipidae; Xenopodinae; Xenopus; Xenopus; Xenopus laevis (African clawed frog) |
| Subcellular Location | Secreted; extracellular space; extracellular matrix |
| Developmental Stage | NA |
| Similarity | Belongs to the peptidase M10A family. |
| Tissue Specificity | Expressed in fibroblast cells that are activated by thyroid hormone. High levels in resorbing tail. |
| Post Translational Modification | NA |
| Function | May be involved in the modification of the extracellular matrix during metamorphic apoptosis. |
| Length | 477 |
| Molecular Weight | 54 |
| Name | Stromelysin-3 |
| Sequence | VLSGGRWDKTNLTYKIIRFPWQLSKVKVRRTIAEALKVWSEVTPLTFTEVHEGRSDIIIDFTRYWHGDNLPFDGPGGILAHAFFPKTHREGDVHFDYDEAWTIGNNIGTDLLQVAAHEFGHMLGLQHSSISKSLMSPFYTFRYPLSLSADDKHGIQFLYGAPRPPTPSPTPRVEVNQVENESNEIPAAEPDACKTNFDAVSTIRGELFFFKSGYVWRLRGGKLQNGYPALASRHWRGIPDTVDAAFEDSVGNIWFFYGSQFWVFDGKLQASGPFPITDIGISVTQIQAAFVWGTEKNKKTYLFRGGEYWRFNPETRRVESRHSRRIGDWRGVPKGIDAAFQDEQGYAYFVKGRQYWKFDPFKVRVMDGYPHLISQDFFNCQASSTFVNSLR |
| Sequence map | 93-57 |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | NA |
| Domain | NA |
| Pharmaceutical Use | NA
|